Recombinant Human DLX3 Protein, GST-tagged
Cat.No. : | DLX3-2693H |
Product Overview : | Human DLX3 full-length ORF ( AAH28970, 1 a.a. - 287 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Many vertebrate homeo box-containing genes have been identified on the basis of their sequence similarity with Drosophila developmental genes. Members of the Dlx gene family contain a homeobox that is related to that of Distal-less (Dll), a gene expressed in the head and limbs of the developing fruit fly. The Distal-less (Dlx) family of genes comprises at least 6 different members, DLX1-DLX6. Trichodentoosseous syndrome (TDO), an autosomal dominant condition, has been correlated with DLX3 gene mutation. This gene is located in a tail-to-tail configuration with another member of the gene family on the long arm of chromosome 17. Mutations in this gene have been associated with the autosomal dominant conditions trichodentoosseous syndrome and amelogenesis imperfecta with taurodontism. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 57.31 kDa |
AA Sequence : | MSGSFDRKLSSILTDISSSLSCHAGSKDSPTLPESSVTDLGYYSAPQHDYYSGQPYGQTVNPYTYHHQFNLNGLAGTGAYSPKSEYTYGASYRQYGAYREQPLPAQDPVSVKEEPEAEVRMVNGKPKKVRKPRTIYSSYQLAALQRRFQKAQYLALPERAELAAQLGLTQTQVKIWFQNRRSKFKKLYKNGEVPLEHSPNNSDSMACNSPPSPALWDTSSHSTPAPARSQLPPPLPYSASPSYLDDPTNSWYHAQNLSGPHLQQQPPQPATLHHASPGPPPNPGAVY |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DLX3 distal-less homeobox 3 [ Homo sapiens ] |
Official Symbol | DLX3 |
Synonyms | DLX3; distal-less homeobox 3; distal less homeo box 3; homeobox protein DLX-3; AI4; TDO; |
Gene ID | 1747 |
mRNA Refseq | NM_005220 |
Protein Refseq | NP_005211 |
MIM | 600525 |
UniProt ID | O60479 |
◆ Recombinant Proteins | ||
DLX3-2693H | Recombinant Human DLX3 Protein, GST-tagged | +Inquiry |
DLX3-774H | Recombinant Human DLX3 Protein, GST-His-tagged | +Inquiry |
DLX3-26675TH | Recombinant Human DLX3 | +Inquiry |
DLX3-6367C | Recombinant Chicken DLX3 | +Inquiry |
DLX3-2482H | Recombinant human DLX3, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DLX3-6906HCL | Recombinant Human DLX3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DLX3 Products
Required fields are marked with *
My Review for All DLX3 Products
Required fields are marked with *
0
Inquiry Basket