Recombinant Human DLX3

Cat.No. : DLX3-26675TH
Product Overview : Recombinant full length Human DLX3 with N terminal proprietary tag, predicted mwt: 57.31 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 287 amino acids
Description : Many vertebrate homeo box-containing genes have been identified on the basis of their sequence similarity with Drosophila developmental genes. Members of the Dlx gene family contain a homeobox that is related to that of Distal-less (Dll), a gene expressed in the head and limbs of the developing fruit fly. The Distal-less (Dlx) family of genes comprises at least 6 different members, DLX1-DLX6. Trichodentoosseous syndrome (TDO), an autosomal dominant condition, has been correlated with DLX3 gene mutation. This gene is located in a tail-to-tail configuration with another member of the gene family on the long arm of chromosome 17. Mutations in this gene have been associated with the autosomal dominant conditions trichodentoosseous syndrome and amelogenesis imperfecta with taurodontism.
Molecular Weight : 57.310kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MSGSFDRKLSSILTDISSSLSCHAGSKDSPTLPESSVTDL GYYSAPQHDYYSGQPYGQTVNPYTYHHQFNLNGLAGTGAY SPKSEYTYGASYRQYGAYREQPLPAQDPVSVKEEPEAEVR MVNGKPKKVRKPRTIYSSYQLAALQRRFQKAQYLALPERA ELAAQLGLTQTQVKIWFQNRRSKFKKLYKNGEVPLEHSPN NSDSMACNSPPSPALWDTSSHSTPAPARSQLPPPLPYSAS PSYLDDPTNSWYHAQNLSGPHLQQQPPQPATLHHASPGPP PNPGAVY
Sequence Similarities : Belongs to the distal-less homeobox family.Contains 1 homeobox DNA-binding domain.
Gene Name DLX3 distal-less homeobox 3 [ Homo sapiens ]
Official Symbol DLX3
Synonyms DLX3; distal-less homeobox 3; distal less homeo box 3; homeobox protein DLX-3;
Gene ID 1747
mRNA Refseq NM_005220
Protein Refseq NP_005211
MIM 600525
Uniprot ID O60479
Chromosome Location 17q21.33
Function sequence-specific DNA binding transcription factor activity; transcription regulatory region sequence-specific DNA binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All DLX3 Products

Required fields are marked with *

My Review for All DLX3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon