Recombinant Human DLK1 protein, His-tagged

• Cat.No.: DLK1-188H
• Product Overview: Recombinant Human DLK1(Ala24-Pro297) fused with His tag at C-terminal was expressed in HEK293.

Specification

• Source: HEK293
• Species: Human
• Tag: His
• Form: Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
• Protein length: Ala24-Pro297
• AA Sequence: AECFPACNPQNGFCEDDNVCRCQPGWQGPLCDQCVTSPGCLHGLCGEPGQCICTDGWDGELCDRD VRACSSAPCANNGTCVSLDDGLYECSCAPGYSGKDCQKKDGPCVINGSPCQHGGTCVDDEGRASH ASCLCPPGFSGNFCEIVANSCTPNPCENDGVCTDIGGDFRCRCPAGFIDKTCSRPVTNCASSPCQ NGGTCLQHTQVSYECLCKPEFTGLTCVKKRALSPQQVTRLPNGYGLAYRLTPGVHELPVQQPEHR ILKVSMKELNKKTPVDHHHHHH
• Endotoxin: Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
• Purity: Greater than 95% as determined by reducing SDS-PAGE.
• Storage: Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days.Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months.
• Reconstitution: Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
• Shipping: The product is shipped at ambient temperature.

Gene Information

• Gene Name: DLK1 delta-like 1 homolog (Drosophila) [ Homo sapiens ]
• Official Symbol: DLK1
• Synonyms: DLK1; delta-like 1 homolog (Drosophila); delta like homolog (Drosophila); protein delta homolog 1; Delta1; FA1; pG2; Pref 1; ZOG; DLK-1; secredeltin; fetal antigen 1; preadipocyte factor 1; DLK; PREF1; Pref-1
• Gene ID: 8788
• mRNA Refseq: NM_003836
• Protein Refseq: NP_003827
• MIM: 176290
• UniProt ID: P80370
• Chromosome Location: 14q32
• Pathway: Activated NOTCH1 Transmits Signal to the Nucleus, organism-specific biosystem; Adipogenesis, organism-specific biosystem; FOXA2 and FOXA3 transcription factor networks, organism-specific biosystem; Notch signaling pathway, organism-specific biosystem; Signal Transduction, organism-specific biosystem; Signaling by NOTCH, organism-specific biosystem; Signaling by NOTCH1, organism-specific biosystem
• Function: molecular_function