Recombinant Human DLG1 Protein, GST-tagged

• Cat.No.: DLG1-2675H
• Product Overview: Human DLG1 partial ORF ( NP_004078, 1 a.a. - 90 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a multi-domain scaffolding protein that is required for normal development. This protein may have a role in septate junction formation, signal transduction, cell proliferation, synaptogenesis and lymphocyte activation. Several alternatively spliced transcript variants encoding different isoforms have been described for this gene, but the full-length nature of some of the variants is not known. [provided by RefSeq, Feb 2011]
• Molecular Mass: 35.64 kDa
• AA Sequence: MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIDIQEFYEVTLLDNPKCIDRSKPSEPIQPVNTWEISSLPSS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DLG1 discs, large homolog 1 (Drosophila) [ Homo sapiens ]
• Official Symbol: DLG1
• Synonyms: DLG1; discs, large homolog 1 (Drosophila); discs, large (Drosophila) homolog 1; disks large homolog 1; discs large homolog 1; dJ1061C18.1.1; DLGH1; hdlg; presynaptic protein SAP97; SAP 97; SAP97; synapse associated protein 97; synapse-associated protein 97; SAP-97; DKFZp761P0818; DKFZp781B0426
• Gene ID: 1739
• mRNA Refseq: NM_001098424
• Protein Refseq: NP_001091894
• MIM: 601014
• UniProt ID: Q12959