Recombinant Human DKK1 protein(32-266 aa), N-SUMO & C-His-tagged

Cat.No. : DKK1-2490H
Product Overview : Recombinant Human DKK1 protein(O94907)(32-266 aa), fused with N-terminal SUMO tag and C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
Protein Length : 32-266 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : TLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQRH
Gene Name DKK1 dickkopf 1 homolog (Xenopus laevis) [ Homo sapiens ]
Official Symbol DKK1
Synonyms DKK1; dickkopf 1 homolog (Xenopus laevis); dickkopf (Xenopus laevis) homolog 1; dickkopf-related protein 1; DKK 1; SK; hDkk-1; dickkopf-1 like; dickkopf related protein-1; DKK-1;
Gene ID 22943
mRNA Refseq NM_012242
Protein Refseq NP_036374
MIM 605189
UniProt ID O94907

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All DKK1 Products

Required fields are marked with *

My Review for All DKK1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon