Recombinant Human DIS3L protein, His-tagged

• Cat.No.: DIS3L-3724H
• Product Overview: Recombinant Human DIS3L protein(727-971 aa), fused to His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• Protein length: 727-971 aa
• AA Sequence: LLMAAISKDKKMEIKGNLFSNKDLEELCRHINNRNQAAQHSQKQSTELFQCMYFKDKDPATEERCISDGVIYSIRTNGVLLFIPRFGIKGAAYLKNKDGLVISCGPDSCSEWKPGSLQRFQNKITSTTTDGESVTFHLFDHVTVRISIQASRCHSDTIRLEIISNKPYKIPNTELIHQSSPLLKSELVKEVTKSVEEAQLAQEVKVNIIQEEYQEYRQTKGRSLYTLLEEIRDLALLDVSNNYGI
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: DIS3L DIS3 mitotic control homolog (S. cerevisiae)-like [ Homo sapiens ]
• Official Symbol: DIS3L
• Synonyms: DIS3L; DIS3 mitotic control homolog (S. cerevisiae)-like; DIS3-like exonuclease 1; FLJ38088; KIAA1955; MGC4562; DIS3L1
• Gene ID: 115752
• mRNA Refseq: NM_001143688
• Protein Refseq: NP_001137160
• MIM: 614183
• UniProt ID: Q8TF46