Recombinant Human DHX8 Protein, GST-tagged
Cat.No. : | DHX8-2615H |
Product Overview : | Human DHX8 partial ORF ( NP_004932, 301 a.a. - 400 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene is a member of the DEAH box polypeptide family. The encoded protein contains the DEAH (Asp-Glu-Ala-His) motif which is characteristic of all DEAH box proteins, and is thought to function as an ATP-dependent RNA helicase that regulates the release of spliced mRNAs from spliceosomes prior to their export from the nucleus. This protein may be required for the replication of human immunodeficiency virus type 1 (HIV-1). Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2014] |
Molecular Mass : | 36.74 kDa |
AA Sequence : | RREGRVANVADVVSKGQRVKVKVLSFTGTKTSLSMKDVDQETGEDLNPNRRRNLVGETNEETSMRNPDRPTHLSLVSAPEVEDDSLERKRLTRISDPEKW |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DHX8 DEAH (Asp-Glu-Ala-His) box polypeptide 8 [ Homo sapiens ] |
Official Symbol | DHX8 |
Synonyms | DHX8; DEAH (Asp-Glu-Ala-His) box polypeptide 8; DDX8, DEAD/H (Asp Glu Ala Asp/His) box polypeptide 8 (RNA helicase); ATP-dependent RNA helicase DHX8; HRH1; PRP22; PRPF22; RNA helicase HRH1; DEAH box protein 8; DEAH-box protein 8; DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 8 (RNA helicase); DDX8; |
Gene ID | 1659 |
mRNA Refseq | NM_004941 |
Protein Refseq | NP_004932 |
MIM | 600396 |
UniProt ID | Q14562 |
◆ Recombinant Proteins | ||
DHX8-27450TH | Recombinant Human DHX8 | +Inquiry |
DHX8-2615H | Recombinant Human DHX8 Protein, GST-tagged | +Inquiry |
DHX8-2605H | Recombinant Human DHX8 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Dhx8-3752M | Recombinant Mouse Dhx8, His-tagged | +Inquiry |
DHX8-2371M | Recombinant Mouse DHX8 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DHX8 Products
Required fields are marked with *
My Review for All DHX8 Products
Required fields are marked with *
0
Inquiry Basket