Recombinant Human DHX8 Protein, GST-tagged

• Cat.No.: DHX8-2615H
• Product Overview: Human DHX8 partial ORF ( NP_004932, 301 a.a. - 400 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene is a member of the DEAH box polypeptide family. The encoded protein contains the DEAH (Asp-Glu-Ala-His) motif which is characteristic of all DEAH box proteins, and is thought to function as an ATP-dependent RNA helicase that regulates the release of spliced mRNAs from spliceosomes prior to their export from the nucleus. This protein may be required for the replication of human immunodeficiency virus type 1 (HIV-1). Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2014]
• Molecular Mass: 36.74 kDa
• AA Sequence: RREGRVANVADVVSKGQRVKVKVLSFTGTKTSLSMKDVDQETGEDLNPNRRRNLVGETNEETSMRNPDRPTHLSLVSAPEVEDDSLERKRLTRISDPEKW
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DHX8 DEAH (Asp-Glu-Ala-His) box polypeptide 8 [ Homo sapiens ]
• Official Symbol: DHX8
• Synonyms: DHX8; DEAH (Asp-Glu-Ala-His) box polypeptide 8; DDX8, DEAD/H (Asp Glu Ala Asp/His) box polypeptide 8 (RNA helicase); ATP-dependent RNA helicase DHX8; HRH1; PRP22; PRPF22; RNA helicase HRH1; DEAH box protein 8; DEAH-box protein 8; DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 8 (RNA helicase); DDX8
• Gene ID: 1659
• mRNA Refseq: NM_004941
• Protein Refseq: NP_004932
• MIM: 600396
• UniProt ID: Q14562