Recombinant Human DHX8
| Cat.No. : | DHX8-27450TH |
| Product Overview : | Recombinant fragment of Human DHX8 with N-terminal proprietary tag. Predicted MW 36.63kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Description : | DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein, which is highly homologous to yeast Prp22. This protein facilitates nuclear export of spliced mRNA by releasing the RNA from the spliceosome. |
| Protein length : | 100 amino acids |
| Molecular Weight : | 36.630kDa inclusive of tags |
| Source : | Wheat germ |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | RREGRVANVADVVSKGQRVKVKVLSFTGTKTSLSMKDVDQETGEDLNPNRRRNLVGETNEETSMRNPDRPTHLSLVSAPEVEDDSLERKRLTRISDPEKW |
| Sequence Similarities : | Belongs to the DEAD box helicase family. DEAH subfamily. DDX8/PRP22 sub-subfamily.Contains 1 helicase ATP-binding domain.Contains 1 helicase C-terminal domain.Contains 1 S1 motif domain. |
| Tag : | Non |
| Gene Name | DHX8 DEAH (Asp-Glu-Ala-His) box polypeptide 8 [ Homo sapiens ] |
| Official Symbol | DHX8 |
| Synonyms | DHX8; DEAH (Asp-Glu-Ala-His) box polypeptide 8; DDX8, DEAD/H (Asp Glu Ala Asp/His) box polypeptide 8 (RNA helicase); ATP-dependent RNA helicase DHX8; HRH1; PRP22; PRPF22; |
| Gene ID | 1659 |
| mRNA Refseq | NM_004941 |
| Protein Refseq | NP_004932 |
| MIM | 600396 |
| Uniprot ID | Q14562 |
| Chromosome Location | 17q21.31 |
| Pathway | Spliceosome, organism-specific biosystem; Spliceosome, conserved biosystem; mRNA processing, organism-specific biosystem; |
| Function | ATP binding; ATP-dependent RNA helicase activity; RNA binding; helicase activity; hydrolase activity; |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DHX8 Products
Required fields are marked with *
My Review for All DHX8 Products
Required fields are marked with *
0
Inquiry Basket
