Recombinant Human DHODH Protein, GST-tagged

Cat.No. : DHODH-2590H
Product Overview : Human DHODH full-length ORF (1 a.a. - 165 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene catalyzes the fourth enzymatic step, the ubiquinone-mediated oxidation of dihydroorotate to orotate, in de novo pyrimidine biosynthesis. This protein is a mitochondrial protein located on the outer surface of the inner mitochondrial membrane. [provided by RefSeq, Jul 2008]
Molecular Mass : 43.9 kDa
AA Sequence : MVPSHSAPPVCLCSAGMDLTVTGFQWWNTGYGPDSRSRPSSQKLGIDGLIVTNTTVSRPAGLQGALRSETGGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSRQDVLEKIRAGASLVQLYTALTFWGPPVVGKVKRELEALLKEQGFGGVTDAIGADHRR
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DHODH dihydroorotate dehydrogenase (quinone) [ Homo sapiens ]
Official Symbol DHODH
Synonyms DHODH; dihydroorotate dehydrogenase (quinone); dihydroorotate dehydrogenase; dihydroorotate dehydrogenase (quinone), mitochondrial; dihydroorotate oxidase; human complement of yeast URA1; URA1; POADS; DHOdehase;
Gene ID 1723
mRNA Refseq NM_001361
Protein Refseq NP_001352
MIM 126064
UniProt ID Q02127

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All DHODH Products

Required fields are marked with *

My Review for All DHODH Products

Required fields are marked with *

0

Inquiry Basket

cartIcon