Recombinant Human DGKE Protein, GST-tagged

• Cat.No.: DGKE-2572H
• Product Overview: Human DGKE full-length ORF ( AAH22297, 1 a.a. - 177 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: Diacylglycerol kinases are thought to be involved mainly in the regeneration of phosphatidylinositol (PI) from diacylglycerol in the PI-cycle during cell signal transduction. When expressed in mammalian cells, DGK-epsilon shows specificity for arachidonyl-containing diacylglycerol. DGK-epsilon is expressed predominantly in testis. [provided by RefSeq, Jul 2008]
• Molecular Mass: 45.21 kDa
• AA Sequence: MEAERRPAPGSPSEGLFADGHLILWTLCSVLLPVFITFWCSLQRSRRQLHRRDIFRKSKHGWRDTDLFSQPTYCCVCAQHILQGAFCDCCGLRVDEGCLRKADKRFQCKEIMLKNDTKVLDAMPHHWIRGNVPLCSYCMVCKQQCGCQPKLCDYRYGLRGHSLSQNAPWESGFHRVV
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DGKE diacylglycerol kinase, epsilon 64kDa [ Homo sapiens ]
• Official Symbol: DGKE
• Synonyms: DGKE; diacylglycerol kinase, epsilon 64kDa; diacylglycerol kinase, epsilon (64kD); diacylglycerol kinase epsilon; DAGK6; DGK; DGK-epsilon; DAG kinase epsilon; diglyceride kinase epsilon; DAGK5
• Gene ID: 8526
• mRNA Refseq: NM_003647
• Protein Refseq: NP_003638
• MIM: 601440
• UniProt ID: P52429