Recombinant Human DGCR6L Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: DGCR6L-6260H
• Product Overview: DGCR6L MS Standard C13 and N15-labeled recombinant protein (NP_150282) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene, the result of a duplication at this locus, is one of two functional genes encoding nearly identical proteins that have similar expression patterns. The product of this gene is a protein that shares homology with the Drosophila gonadal protein, expressed in gonadal tissues and germ cells, and with the human laminin gamma-1 chain that functions in cell attachment and migration. This gene is located in a region of chromosome 22 implicated in the DiGeorge syndrome, one facet of a broader collection of anomalies referred to as the CATCH 22 syndrome.
• Molecular Mass: 24.9 kDa
• AA Sequence: MERYAAALEEVADGARQQERHYQLLSALQSLVKELPSSFQQRLSYTTLSDLALALLDGTVFEIVQGLLEIQHLTEKSLYNQRLRLQNEHRVLRQALRQKHQEAQQACRPHNLPVVQAAQQRELEAVEHRIREEQRAMDQKIILELDRKVADQQSTLEKAGVAGFYVTTNPQELMLQMNLLELIRKLQQRGCRAGNAALGLGGPWQSPAAQCDQKGSPVPPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: DGCR6L DiGeorge syndrome critical region gene 6-like [ Homo sapiens (human) ]
• Official Symbol: DGCR6L
• Synonyms: DGCR6L; DiGeorge syndrome critical region gene 6-like; protein DGCR6L; FLJ10666; DiGeorge syndrome critical region gene 6 like; diGeorge syndrome critical region 6-like protein
• Gene ID: 85359
• mRNA Refseq: NM_033257
• Protein Refseq: NP_150282
• MIM: 609459
• UniProt ID: Q9BY27