Recombinant Full Length Human DGCR6L Protein, GST-tagged

• Cat.No.: DGCR6L-2494HF
• Product Overview: Human DGCR6L full-length ORF ( AAH00682.1, 1 a.a. - 220 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene, the result of a duplication at this locus, is one of two functional genes encoding nearly identical proteins that have similar expression patterns. The product of this gene is a protein that shares homology with the Drosophila gonadal protein, expressed in gonadal tissues and germ cells, and with the human laminin gamma-1 chain that functions in cell attachment and migration. This gene is located in a region of chromosome 22 implicated in the DiGeorge syndrome, one facet of a broader collection of anomalies referred to as the CATCH 22 syndrome. [provided by RefSeq, Jul 2008]
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 51.3 kDa
• Protein length: 220 amino acids
• AA Sequence: MERYAAALEEVADGARQQERHYQLLSALQSLVKELPSSFQQRLSYTTLSDLALALLDGTVFEIVQGLLEIQHLTEKSLYNQRLRLQNEHRVLRQALRQKHQEAQQACRPHNLPVVQAAQQRELEAVEHRIREEQRAMDQKIILELDRKVADQQSTLEKAGVAGFYVTTNPQELMLQMNLLELIRKLQQRGCRAGNAALGLGGPWQSPAAQCDQKGSPVPP
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DGCR6L DiGeorge syndrome critical region gene 6-like [ Homo sapiens ]
• Official Symbol: DGCR6L
• Synonyms: DGCR6L; DiGeorge syndrome critical region gene 6-like; protein DGCR6L; FLJ10666; DiGeorge syndrome critical region gene 6 like; diGeorge syndrome critical region 6-like protein
• Gene ID: 85359
• mRNA Refseq: NM_033257
• Protein Refseq: NP_150282
• MIM: 609459
• UniProt ID: Q9BY27