Recombinant Human DEXI Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | DEXI-938H |
Product Overview : | DEXI MS Standard C13 and N15-labeled recombinant protein (NP_054734) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | DEXI (Dexi Homolog) is a Protein Coding gene. Diseases associated with DEXI include Angelman Syndrome. |
Molecular Mass : | 10.4 kDa |
AA Sequence : | MLGARVAAHLDALGPLVPYVPPPLLPSMFYVGLFFVNVLILYYAFLMEYIVLNVGLVFLPEDMDQALVDLGVLSDPGSGLYDADSELDVFDAYLETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | DEXI Dexi homolog [ Homo sapiens (human) ] |
Official Symbol | DEXI |
Synonyms | DEXI; Dexi homolog; MYLE; dexamethasone-induced protein; dexamethasone-induced transcript |
Gene ID | 28955 |
mRNA Refseq | NM_014015 |
Protein Refseq | NP_054734 |
MIM | 617901 |
UniProt ID | O95424 |
◆ Recombinant Proteins | ||
DEXI-2478HF | Recombinant Full Length Human DEXI Protein, GST-tagged | +Inquiry |
DEXI-2340M | Recombinant Mouse DEXI Protein, His (Fc)-Avi-tagged | +Inquiry |
DEXI-4530M | Recombinant Mouse DEXI Protein | +Inquiry |
DEXI-938H | Recombinant Human DEXI Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
DEXI-2553H | Recombinant Human DEXI Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DEXI-6968HCL | Recombinant Human DEXI 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DEXI Products
Required fields are marked with *
My Review for All DEXI Products
Required fields are marked with *
0
Inquiry Basket