Recombinant Full Length Human DEXI Protein, GST-tagged
Cat.No. : | DEXI-2478HF |
Product Overview : | Human DEXI full-length ORF ( AAH01083, 1 a.a. - 95 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 95 amino acids |
Description : | DEXI (Dexi Homolog) is a Protein Coding gene. Diseases associated with DEXI include Angelman Syndrome. |
Molecular Mass : | 36.19 kDa |
AA Sequence : | MLGARVAAHLDALGPLVPYVPPPLLPSMFYVGLFFVNVLILYYAFLMEYIVLNVGLVFLPEDMDQALVDLGVLSDPGSGLYDADSELDVFDAYLE |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DEXI Dexi homolog (mouse) [ Homo sapiens ] |
Official Symbol | DEXI |
Synonyms | MYLE |
Gene ID | 28955 |
mRNA Refseq | NM_014015.3 |
Protein Refseq | NP_054734.2 |
MIM | 617901 |
UniProt ID | O95424 |
◆ Recombinant Proteins | ||
DEXI-2553H | Recombinant Human DEXI Protein, GST-tagged | +Inquiry |
DEXI-2478HF | Recombinant Full Length Human DEXI Protein, GST-tagged | +Inquiry |
DEXI-11945H | Recombinant Human DEXI, GST-tagged | +Inquiry |
DEXI-4993C | Recombinant Chicken DEXI | +Inquiry |
DEXI-938H | Recombinant Human DEXI Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
DEXI-6968HCL | Recombinant Human DEXI 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DEXI Products
Required fields are marked with *
My Review for All DEXI Products
Required fields are marked with *
0
Inquiry Basket