Recombinant Full Length Human DEXI Protein, GST-tagged

• Cat.No.: DEXI-2478HF
• Product Overview: Human DEXI full-length ORF ( AAH01083, 1 a.a. - 95 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: DEXI (Dexi Homolog) is a Protein Coding gene. Diseases associated with DEXI include Angelman Syndrome.
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 36.19 kDa
• Protein length: 95 amino acids
• AA Sequence: MLGARVAAHLDALGPLVPYVPPPLLPSMFYVGLFFVNVLILYYAFLMEYIVLNVGLVFLPEDMDQALVDLGVLSDPGSGLYDADSELDVFDAYLE
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DEXI Dexi homolog (mouse) [ Homo sapiens ]
• Official Symbol: DEXI
• Synonyms: MYLE
• Gene ID: 28955
• mRNA Refseq: NM_014015.3
• Protein Refseq: NP_054734.2
• MIM: 617901
• UniProt ID: O95424