Recombinant Human DERL1 Protein, GST-tagged

• Cat.No.: DERL1-2546H
• Product Overview: Human DERL1 full-length ORF ( NP_077271.1, 1 a.a. - 251 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene is a member of the derlin family. Members of this family participate in the ER-associated degradation response and retrotranslocate misfolded or unfolded proteins from the ER lumen to the cytosol for proteasomal degradation. This protein recognizes substrate in the ER and works in a complex to retrotranslocate it across the ER membrane into the cytosol. This protein may select cystic fibrosis transmembrane conductance regulator protein (CFTR) for degradation as well as unfolded proteins in Alzheimer's disease. Alternative splicing results in multiple transcript variants that encode different protein isoforms. [provided by RefSeq, Aug 2012]
• Molecular Mass: 55.2 kDa
• AA Sequence: MSDIGDWFRSIPAITRYWFAATVAVPLVGKLGLISPAYLFLWPEAFLYRFQIWRPITATFYFPVGPGTGFLYLVNLYFLYQYSTRLETGAFDGRPADYLFMLLFNWICIVITGLAMDMQLLMIPLIMSVLYVWAQLNRDMIVSFWFGTRFKACYLPWVILGFNYIIGGSVINELIGNLVGHLYFFLMFRYPMDLGGRNFLSTPQFLYRWLPSRRGGVSGFGVPPASMRRAADQNGGGGRHNWGQGFRLGDQ
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DERL1 Der1-like domain family, member 1 [ Homo sapiens ]
• Official Symbol: DERL1
• Synonyms: DERL1; Der1-like domain family, member 1; derlin-1; DER 1; DER1; derlin 1; FLJ13784; MGC3067; PRO2577; DERtrin-1; der1-like protein 1; degradation in endoplasmic reticulum protein 1; DER-1; FLJ42092
• Gene ID: 79139
• mRNA Refseq: NM_001134671
• Protein Refseq: NP_001128143
• MIM: 608813
• UniProt ID: Q9BUN8