Recombinant Full Length Dictyostelium Discoideum Probable Derlin-1 Homolog(Derl1) Protein, His-Tagged
Cat.No. : | RFL22195DF |
Product Overview : | Recombinant Full Length Dictyostelium discoideum Probable derlin-1 homolog(derl1) Protein (Q54IC9) (1-242aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dictyostelium Discoideum |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-242) |
Form : | Lyophilized powder |
AA Sequence : | MDGVKEWFNSIPPVSRYMFAIFLGIPVLAAMHLISFNYLYLDFTFTFKHFHLWRLITAPC IISSLGPMFLFNLIFFYQYTTRLESLNYAGKSDDYLFCIIFISICNIIFGLIFEYYFLGT MTIMSLIYIYSRMNPTGTSNFYGFFSFKTIYLPWVFLVAHFLQTGHPPYSDFLAIVSGHI FFYLTDIYPRANGVPALIKTPKFITNIFNKGDRNPNNVRRDPRTGRPIQEGGYNWGQGHA LG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | derl1 |
Synonyms | derl1; DDB_G0288833; Probable derlin-1 homolog |
UniProt ID | Q54IC9 |
◆ Recombinant Proteins | ||
RFL28598HF | Recombinant Full Length Human Derlin-1(Derl1) Protein, His-Tagged | +Inquiry |
RFL11619BF | Recombinant Full Length Bovine Derlin-1(Derl1) Protein, His-Tagged | +Inquiry |
RFL9795PF | Recombinant Full Length Pongo Abelii Derlin-1(Derl1) Protein, His-Tagged | +Inquiry |
DERL1-1494C | Recombinant Chicken DERL1 | +Inquiry |
DERL1-4523M | Recombinant Mouse DERL1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
DERL1-6971HCL | Recombinant Human DERL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All derl1 Products
Required fields are marked with *
My Review for All derl1 Products
Required fields are marked with *
0
Inquiry Basket