Recombinant Human DENR protein, His-SUMO-tagged

• Cat.No.: DENR-2816H
• Product Overview: Recombinant Human DENR protein(O43583)(2-198aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 2-198aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 38 kDa
• AA Sequence: AADISESSGADCKGDPRNSAKLDADYPLRVLYCGVCSLPTEYCEYMPDVAKCRQWLEKNFPNEFAKLTVENSPKQEAGISEGQGTAGEEEEKKKQKRGGRGQIKQKKKTVPQKVTIAKIPRAKKKYVTRVCGLATFEIDLKEAQRFFAQKFSCGASVTGEDEIIIQGDFTDDIIDVIQEKWPEVDDDSIEDLGEVKK
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: DENR density-regulated protein [ Homo sapiens ]
• Official Symbol: DENR
• Synonyms: DENR; density-regulated protein; DRP; DRP1; SMAP 3; smooth muscle cell associated protein-3; smooth muscle cell-associated protein 3; SMAP-3
• Gene ID: 8562
• mRNA Refseq: NM_003677
• Protein Refseq: NP_003668
• MIM: 604550
• UniProt ID: O43583