Recombinant Full Length Human DENR Protein, GST-tagged

Cat.No. : DENR-2466HF
Product Overview : Human DENR full-length ORF ( NP_003668.2, 1 a.a. - 198 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 198 amino acids
Description : This gene encodes a protein whose expression was found to increase in cultured cells at high density but not during growth arrest. This gene was also shown to have increased expression in cells overexpressing HER-2/neu proto-oncogene. The protein contains an SUI1 domain. In budding yeast, SUI1 is a translation initiation factor that along with eIF-2 and the initiator tRNA-Met, directs the ribosome to the proper translation start site. Proteins similar to SUI have been found in mammals, insects, and plants. [provided by RefSeq, Jul 2008]
Molecular Mass : 48.5 kDa
AA Sequence : MAADISESSGADCKGDPRNSAKLDADYPLRVLYCGVCSLPTEYCEYMPDVAKCRQWLEKNFPNEFAKLTVENSPKQEAGISEGQGTAGEEEEKKKQKRGGRGQIKQKKKTVPQKVTIAKIPRAKKKYVTRVCGLATFEIDLKEAQRFFAQKFSCGASVTGEDEIIIQGDFTDDIIDVIQEKWPEVDDDSIEDLGEVKK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DENR density-regulated protein [ Homo sapiens ]
Official Symbol DENR
Synonyms DENR; density-regulated protein; DRP; DRP1; SMAP 3; smooth muscle cell associated protein-3; smooth muscle cell-associated protein 3; SMAP-3;
Gene ID 8562
mRNA Refseq NM_003677
Protein Refseq NP_003668
MIM 604550
UniProt ID O43583

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All DENR Products

Required fields are marked with *

My Review for All DENR Products

Required fields are marked with *

0

Inquiry Basket

cartIcon