Recombinant Human DENND4A protein, GST-tagged

• Cat.No.: DENND4A-301174H
• Product Overview: Recombinant Human DENND4A (1478-1634 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: Thr1478-Thr1634
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization
• AA Sequence: TTCPFCGNIFLPFLNIEIRDLRRPGRYFLKSSPSTENMHFPSSISSQTRQSCISTSASGLDTSALSVQGNFDLNSKSKLQENFCTRSIQIPANRSKTAMSKCPIFPMARSISTSGPLDKEDTGRQKLISTGSLPATLQGATDSLGLEWHLPSPDPVT
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: DENND4A DENN/MADD domain containing 4A [ Homo sapiens ]
• Official Symbol: DENND4A
• Synonyms: DENND4A; DENN/MADD domain containing 4A; c myc promoter binding protein , MYCPBP; C-myc promoter-binding protein; IRLB; c-myc promoter binding protein; DENN domain-containing protein 4A; MYCPBP; FLJ33949; KIAA0476
• Gene ID: 10260
• mRNA Refseq: NM_001144823
• Protein Refseq: NP_001138295
• MIM: 600382
• UniProt ID: Q7Z401