Recombinant Human DENND4A Protein, GST-tagged

• Cat.No.: DENND4A-5794H
• Product Overview: Human MYCPBP partial ORF ( NP_005839, 1 a.a. - 101 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a DENN domain-containing protein that may function as a guanine nucleotide exchange factor that specifically activates ras-related protein Rab-10. This protein also contains a interferon stimulated response element-binding domain and may be involved in regulating the v-myc avian myelocytomatosis viral (MYC) oncogene. Alternate splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome 8. [provided by RefSeq, Mar 2016]
• Molecular Mass: 36.85 kDa
• AA Sequence: MIEDKGPRVADYFVVAGLTDVSKPLEEEIHFNDACHKVAKPKEPITDVSVIIKSLGEEVPQDYICIDVTPTGLSADLNNGSLVGPQIYLCYRRGRDKPPLT
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DENND4A DENN/MADD domain containing 4A [ Homo sapiens ]
• Official Symbol: DENND4A
• Synonyms: DENND4A; DENN/MADD domain containing 4A; c myc promoter binding protein , MYCPBP; C-myc promoter-binding protein; IRLB; c-myc promoter binding protein; DENN domain-containing protein 4A; MYCPBP; FLJ33949; KIAA0476
• Gene ID: 10260
• mRNA Refseq: NM_001144823
• Protein Refseq: NP_001138295
• MIM: 600382
• UniProt ID: Q7Z401