Recombinant Human DEGS2 Protein, GST-tagged

• Cat.No.: DEGS2-5212H
• Product Overview: Human DEGS2 full-length ORF ( NP_996801.1, 1 a.a. - 323 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a bifunctional enzyme that is involved in the biosynthesis of phytosphingolipids in human skin and in other phytosphingolipid-containing tissues. This enzyme can act as a sphingolipid delta(4)-desaturase, and also as a sphingolipid C4-hydroxylase. [provided by RefSeq, Oct 2008]
• Molecular Mass: 63.6 kDa
• AA Sequence: MGNSASRSDFEWVYTDQPHTQRRKEILAKYPAIKALMRPDPRLKWAVLVLVLVQMLTCWLVRGLAWRWLLFWAYAFGGCVNHSLTLAIHDISHNAAFGTGRAARNRWLAVFANLPVGVPYAASFKKYHVDHHRYLGGDGLDVDVPTRLEGWFFCTPARKLLWLVLQPFFYSLRPLCVHPKAVTRMEVLNTLVQLAADLAIFALWGLKPVVYLLASSFLGLGLHPISGHFVAEHYMFLKGHETYSYYGPLNWITFNVGYHVEHHDFPSIPGYNLPLVRKIAPEYYDHLPQHHSWVKVLWDFVFEDSLGPYARVKRVYRLAKDGL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DEGS2 delta 4-desaturase, sphingolipid 2 [ Homo sapiens (human) ]
• Official Symbol: DEGS2
• Synonyms: DEGS2; delta 4-desaturase, sphingolipid 2; DES2; FADS8; C14orf66; sphingolipid delta(4)-desaturase/C4-monooxygenase DES2; degenerative spermatocyte homolog 2, lipid desaturase; dihydroceramide desaturase 2; sphingolipid 4-desaturase; sphingolipid C4-hydroxylase/delta 4-desaturase; sphingolipid C4-monooxygenase; sphingolipid delta 4 desaturase/C-4 hydroxylase; sphingolipid delta(4)-desaturase 2; sphingolipid delta(4)-desaturase/C4-hydroxylase DES2; EC 1.14.18.5; EC 1.14.19.17
• Gene ID: 123099
• mRNA Refseq: NM_206918
• Protein Refseq: NP_996801
• MIM: 610862
• UniProt ID: Q6QHC5