Recombinant Full Length Human DEGS2 Protein, GST-tagged
Cat.No. : | DEGS2-3835HF |
Product Overview : | Human DEGS2 full-length ORF ( NP_996801.1, 1 a.a. - 323 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 323 amino acids |
Description : | This gene encodes a bifunctional enzyme that is involved in the biosynthesis of phytosphingolipids in human skin and in other phytosphingolipid-containing tissues. This enzyme can act as a sphingolipid delta(4)-desaturase, and also as a sphingolipid C4-hydroxylase. [provided by RefSeq, Oct 2008] |
Molecular Mass : | 63.6 kDa |
AA Sequence : | MGNSASRSDFEWVYTDQPHTQRRKEILAKYPAIKALMRPDPRLKWAVLVLVLVQMLTCWLVRGLAWRWLLFWAYAFGGCVNHSLTLAIHDISHNAAFGTGRAARNRWLAVFANLPVGVPYAASFKKYHVDHHRYLGGDGLDVDVPTRLEGWFFCTPARKLLWLVLQPFFYSLRPLCVHPKAVTRMEVLNTLVQLAADLAIFALWGLKPVVYLLASSFLGLGLHPISGHFVAEHYMFLKGHETYSYYGPLNWITFNVGYHVEHHDFPSIPGYNLPLVRKIAPEYYDHLPQHHSWVKVLWDFVFEDSLGPYARVKRVYRLAKDGL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DEGS2 delta 4-desaturase, sphingolipid 2 [ Homo sapiens (human) ] |
Official Symbol | DEGS2 |
Synonyms | DEGS2; delta 4-desaturase, sphingolipid 2; DES2; FADS8; C14orf66; sphingolipid delta(4)-desaturase/C4-monooxygenase DES2; degenerative spermatocyte homolog 2, lipid desaturase; dihydroceramide desaturase 2; sphingolipid 4-desaturase; sphingolipid C4-hydroxylase/delta 4-desaturase; sphingolipid C4-monooxygenase; sphingolipid delta 4 desaturase/C-4 hydroxylase; sphingolipid delta(4)-desaturase 2; sphingolipid delta(4)-desaturase/C4-hydroxylase DES2; EC 1.14.18.5; EC 1.14.19.17 |
Gene ID | 123099 |
mRNA Refseq | NM_206918 |
Protein Refseq | NP_996801 |
MIM | 610862 |
UniProt ID | Q6QHC5 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DEGS2 Products
Required fields are marked with *
My Review for All DEGS2 Products
Required fields are marked with *
0
Inquiry Basket