Recombinant Human DEFB119 Protein, GST-tagged

• Cat.No.: DEFB119-2525H
• Product Overview: Human DEFB119 full-length ORF (AAH62212.1, 1 a.a. - 84 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a member of the beta subfamily of defensins. Beta-defensins are antimicrobial peptides that protect tissues and organs from infection by a variety of microorganisms. This gene is found in a cluster with other beta-defensin genes on the long arm of chromosome 20. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2014]
• Molecular Mass: 35.64 kDa
• AA Sequence: MKLLYLFLAILLAIEEPVISGKRHILRCMGNSGICRASCKKNEQPYLYCRNCQSCCLQSYMRISISGKEENTDWSYEKQWPRLP
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DEFB119 defensin, beta 119 [ Homo sapiens ]
• Official Symbol: DEFB119
• Synonyms: DEFB-19; DEFB-20; DEFB120; ESC42-RELA; ESC42-RELB
• Gene ID: 245932
• mRNA Refseq: NM_173460.1
• Protein Refseq: NP_775689.1
• UniProt ID: Q8N690