Recombinant Full Length Human DEFB119 Protein, GST-tagged

Cat.No. : DEFB119-2436HF
Product Overview : Human DEFB119 full-length ORF (AAH62212.1, 1 a.a. - 84 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 84 amino acids
Description : This gene encodes a member of the beta subfamily of defensins. Beta-defensins are antimicrobial peptides that protect tissues and organs from infection by a variety of microorganisms. This gene is found in a cluster with other beta-defensin genes on the long arm of chromosome 20. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2014]
Molecular Mass : 35.64 kDa
AA Sequence : MKLLYLFLAILLAIEEPVISGKRHILRCMGNSGICRASCKKNEQPYLYCRNCQSCCLQSYMRISISGKEENTDWSYEKQWPRLP
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DEFB119 defensin, beta 119 [ Homo sapiens ]
Official Symbol DEFB119
Synonyms DEFB-19; DEFB-20; DEFB120; ESC42-RELA; ESC42-RELB
Gene ID 245932
mRNA Refseq NM_173460.1
Protein Refseq NP_775689.1
UniProt ID Q8N690

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All DEFB119 Products

Required fields are marked with *

My Review for All DEFB119 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon