Recombinant Human DEFB118 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: DEFB118-6030H
• Product Overview: DEFB118 MS Standard C13 and N15-labeled recombinant protein (NP_473453) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene encodes a member of the beta subfamily of defensins. Beta-defensins are antimicrobial peptides that protect tissues and organs from infection by a variety of microorganisms. Expression of this gene is regulated by androgen, and the encoded protein binds to sperm and exhibits antibacterial activity against E. coli. This gene is found in a cluster with other beta-defensin genes on the long arm of chromosome 20.
• Molecular Mass: 13.6 kDa
• AA Sequence: MKLLLLALPMLVLLPQVIPAYSGEKKCWNRSGHCRKQCKDGEAVKDTCKNLRACCIPSNEDHRRVPATSPTPLSDSTPGIIDDILTVRFTTDYFEVSSKKDMVEESEAGRGTETSLPNVHHSSTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: DEFB118 defensin beta 118 [ Homo sapiens (human) ]
• Official Symbol: DEFB118
• Synonyms: DEFB118; defensin, beta 118; ESC42; DEFB-18; ESP13.6; C20orf63; beta-defensin 118; defensin, beta 18; epididymal secretory protein 13.6; epididymis secretory sperm binding protein; epididymus specific clone 42
• Gene ID: 117285
• mRNA Refseq: NM_054112
• Protein Refseq: NP_473453
• MIM: 607650
• UniProt ID: Q96PH6