Recombinant Human DEFB109 Protein, GST-tagged

• Cat.No.: DEFB109-2523H
• Product Overview: Human DEFB109 full-length ORF ( AAI48782.1, 1 a.a. - 87 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: DEFB109C (Defensin Beta 109C) is an Uncategorized gene.
• Molecular Mass: 36.52 kDa
• AA Sequence: MRLHLLLLILLLFSILLSPVRGGLGPAEGHCLNLFGVCRTDVCNIVEDQIGACRRRMKCCRAWWILMPIPTPLIMSDYQEPLKPNLK
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DEFB109 defensin, beta 109 [ Homo sapiens ]
• Official Symbol: DEFB109
• Synonyms: DEFB109; defensin, beta 109
• Gene ID: 100286963