Recombinant Full Length Human DEFB109 Protein, GST-tagged
Cat.No. : | DEFB109-2432HF |
Product Overview : | Human DEFB109 full-length ORF ( AAI48782.1, 1 a.a. - 87 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 87 amino acids |
Description : | DEFB109C (Defensin Beta 109C) is an Uncategorized gene. |
Molecular Mass : | 36.52 kDa |
AA Sequence : | MRLHLLLLILLLFSILLSPVRGGLGPAEGHCLNLFGVCRTDVCNIVEDQIGACRRRMKCCRAWWILMPIPTPLIMSDYQEPLKPNLK |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DEFB109 defensin, beta 109 [ Homo sapiens ] |
Official Symbol | DEFB109 |
Synonyms | DEFB109; defensin, beta 109; |
Gene ID | 100286963 |
mRNA Refseq | NM_001037380 |
Protein Refseq | NP_001032457 |
UniProt ID | Q30KL7 |
◆ Recombinant Proteins | ||
DEFB109-2432HF | Recombinant Full Length Human DEFB109 Protein, GST-tagged | +Inquiry |
DEFB109-2523H | Recombinant Human DEFB109 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DEFB109 Products
Required fields are marked with *
My Review for All DEFB109 Products
Required fields are marked with *
0
Inquiry Basket