Recombinant Human DEFA3 Protein (39-94 aa), His-tagged

Cat.No. : DEFA3-2596H
Product Overview : Recombinant Human DEFA3 Protein (39-94 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Yeast
Tag : His
Protein Length : 39-94 aa
Description : Defensin 2 and defensin 3 have antibiotic, fungicide and antiviral activities. Has antimicrobial activity against Gram-negative and Gram-positive bacteria. Defensins are thought to kill microbes by permeabilizing their plasma membrane.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 8.4 kDa
AA Sequence : DIPEVVVSLAWDESLAPKHPGSRKNMDCYCRIPACIAGERRYGTCIYQGRLWAFCC
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name DEFA3 defensin, alpha 3, neutrophil-specific [ Homo sapiens ]
Official Symbol DEFA3
Synonyms DEFA3; DEF3; neutrophil defensin 3; HNP 3; neutrophil peptide 3; HP3; HNP3; HP-3; HNP-3;
Gene ID 1668
mRNA Refseq NM_005217
Protein Refseq NP_005208
MIM 604522
UniProt ID P59666

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All DEFA3 Products

Required fields are marked with *

My Review for All DEFA3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon