Recombinant Human DEFA3 Protein (39-94 aa), His-tagged

• Cat.No.: DEFA3-2596H
• Product Overview: Recombinant Human DEFA3 Protein (39-94 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein.

Specification

• Description: Defensin 2 and defensin 3 have antibiotic, fungicide and antiviral activities. Has antimicrobial activity against Gram-negative and Gram-positive bacteria. Defensins are thought to kill microbes by permeabilizing their plasma membrane.
• Source: Yeast
• Species: Human
• Tag: His
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 8.4 kDa
• Protein length: 39-94 aa
• AA Sequence: DIPEVVVSLAWDESLAPKHPGSRKNMDCYCRIPACIAGERRYGTCIYQGRLWAFCC
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: DEFA3 defensin, alpha 3, neutrophil-specific [ Homo sapiens ]
• Official Symbol: DEFA3
• Synonyms: DEFA3; DEF3; neutrophil defensin 3; HNP 3; neutrophil peptide 3; HP3; HNP3; HP-3; HNP-3
• Gene ID: 1668
• mRNA Refseq: NM_005217
• Protein Refseq: NP_005208
• MIM: 604522
• UniProt ID: P59666