Recombinant Full Length Human DEFA3 Protein, GST-tagged

Cat.No. : DEFA3-2425HF
Product Overview : Human DEFA3 full-length ORF ( NP_005208.1, 1 a.a. - 94 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : Defensins are a family of antimicrobial and cytotoxic peptides thought to be involved in host defense. They are abundant in the granules of neutrophils and also found in the epithelia of mucosal surfaces such as those of the intestine, respiratory tract, urinary tract, and vagina. Members of the defensin family are highly similar in protein sequence and distinguished by a conserved cysteine motif. The protein encoded by this gene, defensin, alpha 3, is found in the microbicidal granules of neutrophils and likely plays a role in phagocyte-mediated host defense. Several alpha defensin genes are clustered on chromosome 8. This gene differs from defensin, alpha 1 by only one amino acid. This gene and the gene encoding defensin, alpha 1 are both subject to copy number variation. [provided by RefSeq, Oct 2014]
Source : In Vitro Cell Free System
Species : Human
Tag : GST
Molecular Mass : 36.6 kDa
Protein length : 94 amino acids
AA Sequence : MRTLAILAAILLVALQAQAEPLQARADEVAAAPEQIAADIPEVVVSLAWDESLAPKHPGSRKNMDCYCRIPACIAGERRYGTCIYQGRLWAFCC
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DEFA3 defensin, alpha 3, neutrophil-specific [ Homo sapiens ]
Official Symbol DEFA3
Synonyms DEFA3; defensin, alpha 3, neutrophil-specific; DEF3; neutrophil defensin 3; HNP 3; neutrophil peptide 3; defensin 3, neutrophil-specific; HP3; HNP3; HP-3; HNP-3;
Gene ID 1668
mRNA Refseq NM_005217
Protein Refseq NP_005208
MIM 604522
UniProt ID P59666

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All DEFA3 Products

Required fields are marked with *

My Review for All DEFA3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon