Recombinant Full Length Human DEFA3 Protein, GST-tagged
Cat.No. : | DEFA3-2425HF |
Product Overview : | Human DEFA3 full-length ORF ( NP_005208.1, 1 a.a. - 94 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 94 amino acids |
Description : | Defensins are a family of antimicrobial and cytotoxic peptides thought to be involved in host defense. They are abundant in the granules of neutrophils and also found in the epithelia of mucosal surfaces such as those of the intestine, respiratory tract, urinary tract, and vagina. Members of the defensin family are highly similar in protein sequence and distinguished by a conserved cysteine motif. The protein encoded by this gene, defensin, alpha 3, is found in the microbicidal granules of neutrophils and likely plays a role in phagocyte-mediated host defense. Several alpha defensin genes are clustered on chromosome 8. This gene differs from defensin, alpha 1 by only one amino acid. This gene and the gene encoding defensin, alpha 1 are both subject to copy number variation. [provided by RefSeq, Oct 2014] |
Molecular Mass : | 36.6 kDa |
AA Sequence : | MRTLAILAAILLVALQAQAEPLQARADEVAAAPEQIAADIPEVVVSLAWDESLAPKHPGSRKNMDCYCRIPACIAGERRYGTCIYQGRLWAFCC |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DEFA3 defensin, alpha 3, neutrophil-specific [ Homo sapiens ] |
Official Symbol | DEFA3 |
Synonyms | DEFA3; defensin, alpha 3, neutrophil-specific; DEF3; neutrophil defensin 3; HNP 3; neutrophil peptide 3; defensin 3, neutrophil-specific; HP3; HNP3; HP-3; HNP-3; |
Gene ID | 1668 |
mRNA Refseq | NM_005217 |
Protein Refseq | NP_005208 |
MIM | 604522 |
UniProt ID | P59666 |
◆ Recombinant Proteins | ||
DEFA3-1141H | Recombinant Human DEFA3 protein, His-tagged | +Inquiry |
DEFA3-1941H | Recombinant Human DEFA3 Protein (Pro21-Cys94), N-GST tagged | +Inquiry |
DEFA3-2596H | Recombinant Human DEFA3 Protein (39-94 aa), His-tagged | +Inquiry |
Defa3-1327M | Recombinant Mouse Defa3 Protein, His-tagged | +Inquiry |
DEFA3-2813H | Recombinant Human DEFA3 protein, His-SUMO-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DEFA3-221HCL | Recombinant Human DEFA3 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DEFA3 Products
Required fields are marked with *
My Review for All DEFA3 Products
Required fields are marked with *
0
Inquiry Basket