Recombinant Human DEF8 Protein, GST-tagged

Cat.No. : DEF8-2517H
Product Overview : Human DEF8 full-length ORF ( ADR82741.1, 1 a.a. - 197 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : DEF8 (Differentially Expressed In FDCP 8 Homolog) is a Protein Coding gene. An important paralog of this gene is PLEKHM1.
Molecular Mass : 21.7 kDa
AA Sequence : MEYDEKLARFRQAHLNPFNKQSGPRQHEQGPGEEVPDVTPEEALPELPPGEPEFRCPERVMDLGLSEDHFSRPVGLFLASDVQQLRQAIEECKQVILELPEQSEKQKDAVVRLIHLRLKLQELKDPNEDEPNIRVLLEHRFYKEKSKSVKQTCDKCNTIIWGLIQTWYTCTGGPRPRRGVRNERDQSSCLRWAHIQM
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DEF8 differentially expressed in FDCP 8 homolog (mouse) [ Homo sapiens ]
Official Symbol DEF8
Synonyms DEF8; differentially expressed in FDCP 8 homolog (mouse); differentially expressed in FDCP 8 homolog; FLJ20186; DEF-8; MGC104349;
Gene ID 54849
mRNA Refseq NM_001242816
Protein Refseq NP_001229745
UniProt ID Q6ZN54

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All DEF8 Products

Required fields are marked with *

My Review for All DEF8 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon