Recombinant Full Length Human DEF8 Protein, GST-tagged

• Cat.No.: DEF8-2423HF
• Product Overview: Human DEF8 full-length ORF ( ADR82741.1, 1 a.a. - 197 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: DEF8 (Differentially Expressed In FDCP 8 Homolog) is a Protein Coding gene. An important paralog of this gene is PLEKHM1.
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 21.7 kDa
• Protein length: 197 amino acids
• AA Sequence: MEYDEKLARFRQAHLNPFNKQSGPRQHEQGPGEEVPDVTPEEALPELPPGEPEFRCPERVMDLGLSEDHFSRPVGLFLASDVQQLRQAIEECKQVILELPEQSEKQKDAVVRLIHLRLKLQELKDPNEDEPNIRVLLEHRFYKEKSKSVKQTCDKCNTIIWGLIQTWYTCTGGPRPRRGVRNERDQSSCLRWAHIQM
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DEF8 differentially expressed in FDCP 8 homolog (mouse) [ Homo sapiens ]
• Official Symbol: DEF8
• Synonyms: DEF8; differentially expressed in FDCP 8 homolog (mouse); differentially expressed in FDCP 8 homolog; FLJ20186; DEF-8; MGC104349
• Gene ID: 54849
• mRNA Refseq: NM_001242816
• Protein Refseq: NP_001229745
• UniProt ID: Q6ZN54