Recombinant Human DEF6 Protein, GST-tagged

Cat.No. : DEF6-2516H
Product Overview : Human DEF6 full-length ORF ( AAH17504, 1 a.a. - 336 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : DEF6, or IBP, is a guanine nucleotide exchange factor (GEF) for RAC (MIM 602048) and CDC42 (MIM 116952) that is highly expressed in B and T cells (Gupta et al., 2003 [PubMed 12923183]).[supplied by OMIM, Mar 2008]
Molecular Mass : 62.7 kDa
AA Sequence : MALRKELLKSIWYAFTALDVEKSGKVSKSQLKVLSHNLYTVLHIPHDPVALEEHFRDDDDGPVSSQGYMPYLNKYILDKVEEGAFVKEHFDELCWTLTAKKNYRADSNGNSMLSNQDAFRLWCLFNFLSEDKYPLIMVPDEVEYLLKKVLSSMSLEVSLGELEELLAQEAQVAQTTGGLSVWQFLELFNSGRCLRGVGRDTLSMAIHEVYQELIQDVLKQGYLWKRGHLRRNWAERWFQLQPSCLCYFGSEECKEKRGIIPLDAHCCVEVLPDRDGKRCMFCVKTATRTYEMSASDTRQRQEWTAAIQMAIRLQAEGKTSLHKDLKQKRREQREQR
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DEF6 differentially expressed in FDCP 6 homolog (mouse) [ Homo sapiens ]
Official Symbol DEF6
Synonyms DEF6; differentially expressed in FDCP 6 homolog (mouse); differentially expressed in FDCP (mouse homolog) 6; differentially expressed in FDCP 6 homolog; IBP; SLAT; SWAP 70 like adaptor protein of T cells; SWAP70L; DEF-6; IRF4-binding protein; SWAP-70-like adaptor protein of T cells;
Gene ID 50619
mRNA Refseq NM_022047
Protein Refseq NP_071330
MIM 610094
UniProt ID Q9H4E7

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All DEF6 Products

Required fields are marked with *

My Review for All DEF6 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon