Recombinant Full Length Human DEF6 Protein, GST-tagged

• Cat.No.: DEF6-2421HF
• Product Overview: Human DEF6 full-length ORF ( AAH17504, 1 a.a. - 336 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: DEF6, or IBP, is a guanine nucleotide exchange factor (GEF) for RAC (MIM 602048) and CDC42 (MIM 116952) that is highly expressed in B and T cells (Gupta et al., 2003 [PubMed 12923183]).[supplied by OMIM, Mar 2008]
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 62.7 kDa
• Protein length: 336 amino acids
• AA Sequence: MALRKELLKSIWYAFTALDVEKSGKVSKSQLKVLSHNLYTVLHIPHDPVALEEHFRDDDDGPVSSQGYMPYLNKYILDKVEEGAFVKEHFDELCWTLTAKKNYRADSNGNSMLSNQDAFRLWCLFNFLSEDKYPLIMVPDEVEYLLKKVLSSMSLEVSLGELEELLAQEAQVAQTTGGLSVWQFLELFNSGRCLRGVGRDTLSMAIHEVYQELIQDVLKQGYLWKRGHLRRNWAERWFQLQPSCLCYFGSEECKEKRGIIPLDAHCCVEVLPDRDGKRCMFCVKTATRTYEMSASDTRQRQEWTAAIQMAIRLQAEGKTSLHKDLKQKRREQREQR
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DEF6 differentially expressed in FDCP 6 homolog (mouse) [ Homo sapiens ]
• Official Symbol: DEF6
• Synonyms: DEF6; differentially expressed in FDCP 6 homolog (mouse); differentially expressed in FDCP (mouse homolog) 6; differentially expressed in FDCP 6 homolog; IBP; SLAT; SWAP 70 like adaptor protein of T cells; SWAP70L; DEF-6; IRF4-binding protein; SWAP-70-like adaptor protein of T cells
• Gene ID: 50619
• mRNA Refseq: NM_022047
• Protein Refseq: NP_071330
• MIM: 610094
• UniProt ID: Q9H4E7