Recombinant Human DDX60 Protein, GST-tagged

Cat.No. : DDX60-4253H
Product Overview : Human FLJ20035 full-length ORF ( AAH20601.1, 1 a.a. - 183 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases which are implicated in a number of cellular procsses involving RNA binding and alteration of RNA secondary structure. This gene encodes a DEXD/H box RNA helicase that functions as an antiviral factor and promotes RIG-I-like receptor-mediated signaling. [provided by RefSeq, Apr 2017]
Molecular Mass : 47.2 kDa
AA Sequence : MKIMEDFTTFLRIVSKLADMNQEYQLPLSKIKFTGKECEDSQLVSHLMSCKEGRVAISPFVCLSGNFDDDLLRLETPNHVTLGTIGVNRSQAPVLLSQKFDNRGRKMSLNAYALDFYKHGSLIGLVQDNRMNEGDAYYLLKDFALTIKSISVSLRELCENEDDNVVLAFEQLSTTFWEKLNKV
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DDX60 DEAD (Asp-Glu-Ala-Asp) box polypeptide 60 [ Homo sapiens ]
Official Symbol DDX60
Synonyms DExD/H-Box Helicase 60; DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 60; DEAD Box Protein 60; EC 3.6.4.13; DDX60; DEAD (Asp-Glu-Ala-Asp) box polypeptide 60
Gene ID 55601
mRNA Refseq NM_017631
Protein Refseq NP_060101
MIM 613974
UniProt ID Q8IY21

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All DDX60 Products

Required fields are marked with *

My Review for All DDX60 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon