Recombinant Full Length Human DDX60 Protein, GST-tagged

• Cat.No.: DDX60-4879HF
• Product Overview: Human FLJ20035 full-length ORF ( AAH20601.1, 1 a.a. - 183 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases which are implicated in a number of cellular procsses involving RNA binding and alteration of RNA secondary structure. This gene encodes a DEXD/H box RNA helicase that functions as an antiviral factor and promotes RIG-I-like receptor-mediated signaling. [provided by RefSeq, Apr 2017]
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 47.2 kDa
• Protein length: 183 amino acids
• AA Sequence: MKIMEDFTTFLRIVSKLADMNQEYQLPLSKIKFTGKECEDSQLVSHLMSCKEGRVAISPFVCLSGNFDDDLLRLETPNHVTLGTIGVNRSQAPVLLSQKFDNRGRKMSLNAYALDFYKHGSLIGLVQDNRMNEGDAYYLLKDFALTIKSISVSLRELCENEDDNVVLAFEQLSTTFWEKLNKV
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DDX60 DEAD (Asp-Glu-Ala-Asp) box polypeptide 60 [ Homo sapiens ]
• Official Symbol: DDX60
• Synonyms: DExD/H-Box Helicase 60; DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 60; DEAD Box Protein 60; EC 3.6.4.13; DDX60; DEAD (Asp-Glu-Ala-Asp) box polypeptide 60
• Gene ID: 55601
• mRNA Refseq: NM_017631
• Protein Refseq: NP_060101
• MIM: 613974
• UniProt ID: Q8IY21