Recombinant Human DDX54 protein, GST-tagged

• Cat.No.: DDX54-301250H
• Product Overview: Recombinant Human DDX54 (778-881 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: Asp778-Met881
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: DDRDSDEEGASDRRGPERRGGKRDRGQGASRPHAPGTPAGRVRPELKTKQQILKQRRRAQKLHFLQRGGLKQLSARNRRRVQELQQGAFGRGARSKKGKMRKRM
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: DDX54 DEAD (Asp-Glu-Ala-Asp) box polypeptide 54 [ Homo sapiens ]
• Official Symbol: DDX54
• Synonyms: DDX54; DEAD (Asp-Glu-Ala-Asp) box polypeptide 54; ATP-dependent RNA helicase DDX54; APR 5; DP97; MGC2835; DEAD box protein 54; DEAD box helicase 97 KDa; DEAD box RNA helicase 97 kDa; ATP-dependent RNA helicase DP97
• Gene ID: 79039
• mRNA Refseq: NM_001111322
• Protein Refseq: NP_001104792
• MIM: 611665
• UniProt ID: Q8TDD1