Recombinant Human DDX54 Protein, GST-tagged

• Cat.No.: DDX54-2502H
• Product Overview: Human DDX54 partial ORF ( NP_076977, 778 a.a. - 881 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a member of the DEAD box protein family. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. The nucleolar protein encoded by this gene interacts in a hormone-dependent manner with nuclear receptors, and represses their transcriptional activity. Alternative splice variants that encode different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
• Molecular Mass: 37.18 kDa
• AA Sequence: DDRDSDEEGASDRRGPERRGGKRDRGQGASRPHAPGTPAGRVRPELKTKQQILKQRRRAQKLHFLQRGGLKQLSARNRRRVQELQQGAFGRGARSKKGKMRKRM
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DDX54 DEAD (Asp-Glu-Ala-Asp) box polypeptide 54 [ Homo sapiens ]
• Official Symbol: DDX54
• Synonyms: DDX54; DEAD (Asp-Glu-Ala-Asp) box polypeptide 54; ATP-dependent RNA helicase DDX54; APR 5; DP97; MGC2835; DEAD box protein 54; DEAD box helicase 97 KDa; DEAD box RNA helicase 97 kDa; ATP-dependent RNA helicase DP97
• Gene ID: 79039
• mRNA Refseq: NM_001111322
• Protein Refseq: NP_001104792
• MIM: 611665
• UniProt ID: Q8TDD1