Recombinant Human DDX4 Protein, His-tagged

Cat.No. : DDX4-001H
Product Overview : DDX4-001H Recombinant Human DDX4 Protein, C-His-tagged,expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Source : E. coli
Species : Human
Tag : C-His
Protein length : 1-145 aa
Molecular Mass : 17 kDa
AA Sequence : MGDEDWEAEINPHMSSYVPIFEKDRYSGENGDNFNRTPASSSEMDDGPSRRDHFMKSGFASGRNFGNRDAGECNKRDNTSTMGGFGVGKSFGNRGFSNSRFEDGDSSGFWRESSNDCEDNPTRNRGFSKRGGYRDGNNSEASGPYHHHHHHHH
Purity : >90% by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 °C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 1mg/ml by BCA
Storage Buffer : Sterile PBS, pH 7.4, 10% Glycerol, 5% Trehalose
Gene Name DDX4 DEAD-box helicase 4 [ Homo sapiens (human) ]
Official Symbol DDX4
Synonyms DDX4,DEAD (Asp-Glu-Ala-Asp) box polypeptide 4,DEAD/H (Asp Glu Ala Asp/His) box polypeptide 4,probable ATP-dependent RNA helicase DDX4,VASA,vasa homolog,DEAD box protein 4,DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 4, MGC111074
Gene ID 54514
MIM 605281
UniProt ID Q9NQI0

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All DDX4 Products

Required fields are marked with *

My Review for All DDX4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon