Recombinant Human DDB1 protein, His-tagged

• Cat.No.: DDB1-11877H
• Product Overview: Recombinant Human DDB1 protein(1-400 aa), fused with His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• ProteinLength: 1-400 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: MSYNYVVTAQKPTAVNGCVTGHFTSAEDLNLLIAKNTRLEIYVVTAEGLRPVKEVGMYGKIAVMELFRPKGESKDLLFILTAKYNACILEYKQSGESIDIITRAHGNVQDRIGRPSETGIIGIIDPECRMIGLRLYDGLFKVIPLDRDNKELKAFNIRLEELHVIDVKFLYGCQAPTICFVYQDPQGRHVKTYEVSLREKEFNKGPWKQENVEAEASMVIAVPEPFGGAIIIGQESITYHNGDKYLAIAPPIIKQSTIVCHNRVDPNGSRYLLGDMEGRLFMLLLEKEEQMDGTVTLKDLRVELLGETSIAECLTYLDNGVVFVGSRLGDSQLVKLNVDSNEQGSYVVAMETFTNLGPIVDMCVVDLERQGQGQLVTCSGAFKEGSLRIIRNGIGIHEHA
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: DDB1 damage-specific DNA binding protein 1, 127kDa [ Homo sapiens ]
• Official Symbol: DDB1
• Synonyms: DDB1; damage-specific DNA binding protein 1, 127kDa; damage specific DNA binding protein 1 (127kD); DNA damage-binding protein 1; XPE; XAP-1; UV-DDB 1; DDB p127 subunit; XPE-binding factor; HBV X-associated protein 1; DNA damage-binding protein a; UV-damaged DNA-binding factor; UV-damaged DNA-binding protein 1; damage-specific DNA-binding protein 1; xeroderma pigmentosum group E-complementing protein; DDBA; XAP1; XPCE; XPE-BF; UV-DDB1
• Gene ID: 1642
• mRNA Refseq: NM_001923
• Protein Refseq: NP_001914
• MIM: 600045
• UniProt ID: Q16531