Recombinant Human DDB1 protein, His-tagged

Cat.No. : DDB1-11877H
Product Overview : Recombinant Human DDB1 protein(1-400 aa), fused with His tag, was expressed in E.coli.
Availability April 20, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-400 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : MSYNYVVTAQKPTAVNGCVTGHFTSAEDLNLLIAKNTRLEIYVVTAEGLRPVKEVGMYGKIAVMELFRPKGESKDLLFILTAKYNACILEYKQSGESIDIITRAHGNVQDRIGRPSETGIIGIIDPECRMIGLRLYDGLFKVIPLDRDNKELKAFNIRLEELHVIDVKFLYGCQAPTICFVYQDPQGRHVKTYEVSLREKEFNKGPWKQENVEAEASMVIAVPEPFGGAIIIGQESITYHNGDKYLAIAPPIIKQSTIVCHNRVDPNGSRYLLGDMEGRLFMLLLEKEEQMDGTVTLKDLRVELLGETSIAECLTYLDNGVVFVGSRLGDSQLVKLNVDSNEQGSYVVAMETFTNLGPIVDMCVVDLERQGQGQLVTCSGAFKEGSLRIIRNGIGIHEHA
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name DDB1 damage-specific DNA binding protein 1, 127kDa [ Homo sapiens ]
Official Symbol DDB1
Synonyms DDB1; damage-specific DNA binding protein 1, 127kDa; damage specific DNA binding protein 1 (127kD); DNA damage-binding protein 1; XPE; XAP-1; UV-DDB 1; DDB p127 subunit; XPE-binding factor; HBV X-associated protein 1; DNA damage-binding protein a; UV-damaged DNA-binding factor; UV-damaged DNA-binding protein 1; damage-specific DNA-binding protein 1; xeroderma pigmentosum group E-complementing protein; DDBA; XAP1; XPCE; XPE-BF; UV-DDB1;
Gene ID 1642
mRNA Refseq NM_001923
Protein Refseq NP_001914
MIM 600045
UniProt ID Q16531

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All DDB1 Products

Required fields are marked with *

My Review for All DDB1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon