Recombinant Full Length Human DDB1 Protein, GST-tagged
Cat.No. : | DDB1-6896HF |
Product Overview : | Recombinant Human full-length DDB1(1 a.a. - 1140 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
ProteinLength : | 1140 amino acids |
Description : | The protein encoded by this gene is the large subunit (p127) of the heterodimeric DNA damage-binding (DDB) complex while another protein (p48) forms the small subunit. This protein complex functions in nucleotide-excision repair and binds to DNA following UV damage. Defective activity of this complex causes the repair defect in patients with xeroderma pigmentosum complementation group E (XPE) - an autosomal recessive disorder characterized by photosensitivity and early onset of carcinomas. However, it remains for mutation analysis to demonstrate whether the defect in XPE patients is in this gene or the gene encoding the small subunit. In addition, Best vitelliform mascular dystrophy is mapped to the same region as this gene on 11q, but no sequence alternations of this gene are demonstrated in Best disease patients. The protein encoded by this gene also functions as an adaptor molecule for the cullin 4 (CUL4) ubiquitin E3 ligase complex by facilitating the binding of substrates to this complex and the ubiquitination of proteins. |
Form : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 153.4 kDa |
AA Sequence : | MSYNYVVTAQKPTAVNGCVTGHFTSAEDLNLLIAKNTRLEIYVVTAEGLRPVKEVGMYGKIAVMELFRPKGESKD LLFILTAKYNACILEYKQSGESIDIITRAHGNVQDRIGRPSETGIIGIIDPECRMIGLRLYDGLFKVIPLDRDNK ELKAFNIRLEELHVIDVKFLYGCQAPTICFVYQDPQGRHVKTYEVSLREKEFNKGPWKQENVEAEASMVIAVPEP FGGAIIIGQESITYHNGDKYLAIAPPIIKQSTIVCHNRVDPNGSRYLLGDMEGRLFMLLLEKEEQMDGTVTLKDL RVELLGETSIAECLTYLDNGVVFVGSRLGDSQLVKLNVDSNEQGSYVVAMETFTNLGPIVDMCVVDLERQGQGQL VTCSGAFKEGSLRIIRNGIGIHEHASIDLPGIKGLWPLRSDPNRETDDTLVLSFVGQTRVLMLNGEEVEETELMG FVDDQQTFFCGNVAHQQLIQITSASVRLVSQEPKALVSEWKEPQAKNISVASCNSSQVVVAVGRALYYLQIHPQE LRQISHTEMEHEVACLDITPLGDSNGLSPLCAIGLWTDISARILKLPSFELLHKEMLGGEIIPRSILMTTFESSH YLLCALGDGALFYFGLNIETGLLSDRKKVTLGTQPTVLRTFRSLSTTNVFACSDRPTVIYSSNHKLVFSNVNLKE VNYMCPLNSDGYPDSLALANNSTLTIGTIDEIQKLHIRTVPLYESPRKICYQEVSQCFGVLSSRIEVQDTSGGTT ALRPSASTQALSSSVSSSKLFSSSTAPHETSFGEEVEVHNLLIIDQHTFEVLHAHQFLQNEYALSLVSCKLGKDP NTYFIVGTAMVYPEEAEPKQGRIVVFQYSDGKLQTVAEKEVKGAVYSMVEFNGKLLASINSTVRLYEWTTEKELR TECNHYNNIMALYLKTKGDFILVGDLMRSVLLLAYKPMEGNFEEIARDFNPNWMSAVEILDDDNFLGAENAFNLF VCQKDSAATTDEERQHLQEVGLFHLGEFVNVFCHGSLVMQNLGETSTPTQGSVLFGTVNGMIGLVTSLSESWYNL LLDMQNRLNKVIKSVGKIEHSFWRSFHTERKTEPATGFIDGDLIESFLDISRPKMQEVVANLQYDDGSGMKREAT ADDLIKVVEELTRIH |
Applications : | Enzyme-linked Immunoabsorbent; Assay Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | DDB1 damage specific DNA binding protein 1 [ Homo sapiens (human) ] |
Official Symbol | DDB1 |
Synonyms | DDB1; damage-specific DNA binding protein 1, 127kDa; damage specific DNA binding protein 1 (127kD); DNA damage-binding protein 1; XPE; XAP-1; UV-DDB 1; DDB p127 subunit; XPE-binding factor; HBV X-associated protein 1; DNA damage-binding protein a; UV-damaged DNA-binding factor; UV-damaged DNA-binding protein 1; damage-specific DNA-binding protein 1; xeroderma pigmentosum group E-complementing protein; DDBA; XAP1; XPCE; XPE-BF; UV-DDB1; |
Gene ID | 1642 |
mRNA Refseq | NM_001923 |
Protein Refseq | NP_001914 |
MIM | 600045 |
UniProt ID | Q16531 |
◆ Native Proteins | ||
PLG-27842TH | Native Human PLG | +Inquiry |
ADPGK-45 | Active Native ADP-specific glucokinase | +Inquiry |
CAT-1646H | Native Human Catalase Protein | +Inquiry |
ApoA-I-3554H | Native Human ApoA-I | +Inquiry |
ACTA1-854P | Native Porcine ACTA1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
Uterus-76H | Human Uterus Tissue Lysate | +Inquiry |
PTK7-2697HCL | Recombinant Human PTK7 293 Cell Lysate | +Inquiry |
UIMC1-506HCL | Recombinant Human UIMC1 293 Cell Lysate | +Inquiry |
FGFR4-2757MCL | Recombinant Mouse FGFR4 cell lysate | +Inquiry |
PTPRO-2672HCL | Recombinant Human PTPRO 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DDB1 Products
Required fields are marked with *
My Review for All DDB1 Products
Required fields are marked with *
0
Inquiry Basket