Recombinant Human DCUN1D2 Protein, GST-tagged
Cat.No. : | DCUN1D2-2419H |
Product Overview : | Human DCUN1D2 full-length ORF ( NP_001014305.1, 1 a.a. - 259 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Description : | DCUN1D2 (Defective In Cullin Neddylation 1 Domain Containing 2) is a Protein Coding gene. An important paralog of this gene is DCUN1D1. |
Source : | Wheat Germ |
Species : | Human |
Tag : | GST |
Molecular Mass : | 56.6 kDa |
AA Sequence : | MHKLKSSQKDKVRQFMACTQAGERTAIYCLTQNEWRLDEATDSFFQNPDSLHRESMRNAVDKKKLERLYGRYKDPQDENKIGVDGIQQFCDDLSLDPASISVLVIAWKFRAATQCEFSRKEFLDGMTELGCDSMEKLKALLPRLEQELKDTAKFKDFYQFTFTFAKNPGQKGLDLEMAVAYWKLVLSGRFKFLDLWNTFLMEHHKRSIPRDTWNLLLDFGNMIADDMSNYDEEGAWPVLIDDFVEYARPVVTGGKRSLF |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DCUN1D2 DCN1, defective in cullin neddylation 1, domain containing 2 (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | DCUN1D2 |
Synonyms | DCUN1D2; DCN1, defective in cullin neddylation 1, domain containing 2 (S. cerevisiae); C13orf17, chromosome 13 open reading frame 17; DCN1-like protein 2; FLJ10704; FLJ20092; DCUN1 domain-containing protein 2; defective in cullin neddylation protein 1-like protein 2; C13orf17; |
Gene ID | 55208 |
mRNA Refseq | NM_001014283 |
Protein Refseq | NP_001014305 |
UniProt ID | Q6PH85 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All DCUN1D2 Products
Required fields are marked with *
My Review for All DCUN1D2 Products
Required fields are marked with *
0
Inquiry Basket