Recombinant Human DCUN1D2, His-tagged

• Cat.No.: DCUN1D2-26557TH
• Product Overview: Recombinant full length Human DCUN1D2 with an N terminal His tag; 279 amino acids including tag, Predicted MWt 32.3 kDa.

Specification

• Description: May contribute to neddylation of cullin components of SCF-type E3 ubiquitin ligase complexes. Neddylation of cullins play an essential role in the regulation of SCF-type complexes activity (By similarity).
• Protein length: 259 amino acids
• Conjugation: HIS
• Molecular Weight: 32.300kDa inclusive of tags
• Source: E. coli
• Form: Liquid
• Purity: >95% by SDS-PAGE
• Storage buffer: pH: 8.00Constituents:0.32% Tris HCl, 0.02% DTT, 30% Glycerol, 0.58% Sodium chloride
• Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMHKLKSSQKDKVRQFMACTQAGERTAIYCLTQNEWRLDEATDSFFQNPDSLHRESMRNAVDKKKLERLYGRYKDPQDENKIGVDGIQQFCDDLSLDPASISVLVIAWKFRAATQCEFSRKEFLDGMTELGCDSMEKLKALLPRLEQELKDTAKFKDFYQFTFTFAKNPGQKGLDLEMAVAYWKLVLSGRFKFLDLWNTFLMEHHKRSIPRDTWNLLLDFGNMIADDMSNYDEEGAWPVLIDDFVEYARPVVTGGKRSLF
• Sequence Similarities: Contains 1 DCUN1 domain.Contains 1 UBA-like domain.

Gene Information

• Gene Name: DCUN1D2 DCN1, defective in cullin neddylation 1, domain containing 2 (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: DCUN1D2
• Synonyms: DCUN1D2; DCN1, defective in cullin neddylation 1, domain containing 2 (S. cerevisiae); C13orf17, chromosome 13 open reading frame 17; DCN1-like protein 2; FLJ10704; FLJ20092
• Gene ID: 55208
• mRNA Refseq: NM_001014283
• Protein Refseq: NP_001014305
• Uniprot ID: Q6PH85
• Chromosome Location: 13q34