Recombinant Human DCTN3 Protein, GST-tagged

• Cat.No.: DCTN3-2413H
• Product Overview: Human DCTN3 full-length ORF ( AAH00319, 1 a.a. - 176 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes the smallest subunit of dynactin, a macromolecular complex consisting of 10 subunits ranging in size from 22 to 150 kD. Dynactin binds to both microtubules and cytoplasmic dynein. It is involved in a diverse array of cellular functions, including ER-to-Golgi transport, the centripetal movement of lysosomes and endosomes, spindle formation, cytokinesis, chromosome movement, nuclear positioning, and axonogenesis. This subunit, like most other dynactin subunits, exists only as a part of the dynactin complex. It is primarily an alpha-helical protein with very little coiled coil, and binds directly to the largest subunit (p150) of dynactin. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 44.88 kDa
• AA Sequence: MAGLTDLQRLQARVEELERWVYGPGGARGSRKVADGLVKVQVALGNISSKRERVKILYKKIEDLIKYLDPEYIDRIAIPDASKLQFILAEEQFILSQVALLEQVNALVPMLDSAHIKAVPEHAARLQRLAQIHIQQQAPWGVGVRDEAGSLVEDVGFAQFLSVLHFGPTGPVCGNH
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DCTN3 dynactin 3 (p22) [ Homo sapiens ]
• Official Symbol: DCTN3
• Synonyms: DCTN3; dynactin 3 (p22); dynactin subunit 3; DCTN 22; p22; dynactin light chain; dynactin 3, isoform 1; dynactin complex subunit 22 kDa subunit; DCTN22; DCTN-22; MGC111190
• Gene ID: 11258
• mRNA Refseq: NM_007234
• Protein Refseq: NP_009165
• MIM: 607387
• UniProt ID: O75935