Recombinant Human DCTN3 Protein (2-176 aa), His-SUMO-tagged

• Cat.No.: DCTN3-451H
• Product Overview: Recombinant Human DCTN3 Protein (2-176 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Cell Cycle. Protein Description: Full Length of Mature Protein.

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 2-176 aa
• Description: Together with dynein may be involved in spindle assbly and cytokinesis.
• Form: Tris-based buffer, 50% glycerol
• Molecular Mass: 35.3 kDa
• AA Sequence: AGLTDLQRLQARVEELERWVYGPGGARGSRKVADGLVKVQVALGNISSKRERVKILYKKIEDLIKYLDPEYIDRIAIPDASKLQFILAEEQFILSQVALLEQVNALVPMLDSAHIKAVPEHAARLQRLAQIHIQQQAPWGVGVRDEAGSLVEDVGFAQFLSVLHFGPTGPVCGNH
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with concentration instruction is sent along with the products.

Gene Information

• Gene Name: DCTN3 dynactin 3 (p22) [ Homo sapiens ]
• Official Symbol: DCTN3
• Synonyms: DCTN3; dynactin 3 (p22); DCTN 22; p22; DCTN22; DCTN-22; MGC111190
• Gene ID: 11258
• mRNA Refseq: NM_007234
• Protein Refseq: NP_009165
• MIM: 607387
• UniProt ID: O75935