Recombinant Human DCTD Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | DCTD-4638H |
Product Overview : | DCTD MS Standard C13 and N15-labeled recombinant protein (NP_001912) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene catalyzes the deamination of dCMP to dUMP, the nucleotide substrate for thymidylate synthase. The encoded protein is allosterically activated by dCTP and inhibited by dTTP, and is found as a homohexamer. This protein uses zinc as a cofactor for its activity. Two transcript variants encoding different isoforms have been found for this gene. |
Molecular Mass : | 21.01 kDa |
AA Sequence : | MVGGGQPCGPNMSEVSCKKRDDYLEWPEYFMAVAFLSAQRSKDPNSQVGACIVNSENKIVGIGYNGMPNGCSDDVLPWRRTAENKLDTKYPYVCHAELNAIMNKNSTDVKGCSMYVALFPCNECAKLIIQAGIKEVIFMSDKYHDSDEATAARLLFNMAGVTFRKFIPKCSKIVIDFDSINSRPSQKLQTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | DCTD dCMP deaminase [ Homo sapiens (human) ] |
Official Symbol | DCTD |
Synonyms | DCTD; dCMP deaminase; deoxycytidylate deaminase; MGC111062; |
Gene ID | 1635 |
mRNA Refseq | NM_001921 |
Protein Refseq | NP_001912 |
MIM | 607638 |
UniProt ID | P32321 |
◆ Recombinant Proteins | ||
DCTD-732H | Recombinant Human dCMP Deaminase, His-tagged | +Inquiry |
DCTD-2409Z | Recombinant Zebrafish DCTD | +Inquiry |
DCTD-1019R | Recombinant Rhesus Macaque DCTD Protein, His (Fc)-Avi-tagged | +Inquiry |
DCTD-2937HF | Recombinant Full Length Human DCTD Protein, GST-tagged | +Inquiry |
DCTD-4638H | Recombinant Human DCTD Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
DCTD-7044HCL | Recombinant Human DCTD 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DCTD Products
Required fields are marked with *
My Review for All DCTD Products
Required fields are marked with *
0
Inquiry Basket