Recombinant Full Length Human DCTD Protein, GST-tagged

• Cat.No.: DCTD-2937HF
• Product Overview: Human DCTD full-length ORF ( NP_001012750.1, 1 a.a. - 189 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 189 amino acids
• Description: The protein encoded by this gene catalyzes the deamination of dCMP to dUMP, the nucleotide substrate for thymidylate synthase. The encoded protein is allosterically activated by dCTP and inhibited by dTTP, and is found as a homohexamer. This protein uses zinc as a cofactor for its activity. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
• Molecular Mass: 47.4 kDa
• AA Sequence: MVGGGQPCGPNMSEVSCKKRDDYLEWPEYFMAVAFLSAQRSKDPNSQVGACIVNSENKIVGIGYNGMPNGCSDDVLPWRRTAENKLDTKYPYVCHAELNAIMNKNSTDVKGCSMYVALFPCNECAKLIIQAGIKEVIFMSDKYHDSDEATAARLLFNMAGVTFRKFIPKCSKIVIDFDSINSRPSQKLQ
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DCTD dCMP deaminase [ Homo sapiens ]
• Official Symbol: DCTD
• Synonyms: DCTD; dCMP deaminase; deoxycytidylate deaminase; MGC111062
• Gene ID: 1635
• mRNA Refseq: NM_001012732
• Protein Refseq: NP_001012750
• MIM: 607638
• UniProt ID: P32321