Recombinant Human DCPS protein(7-160 aa), His-tagged

Source :	E.coli
Species :	Human
Tag :	His
Protein length :	7-160 aa
Form :	The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence :	QLGKRKRELDVEEAHAASTEEKEAGVGNGTCAPVRLPFSGFRLQKVLRESARDKIIFLHGKVNEASEDGDGEDAVVILEKTPFQVEQVAQLLTGSPELQLQFSNDIYSTYHLFPPRQLNDVKTTVVYPATEKHLQKYLRQDLRLIRETGDDYRN
Purity :	85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage :	Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution :	Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.

Gene Name	DCPS decapping enzyme, scavenger [ Homo sapiens ]
Official Symbol	DCPS
Synonyms	DCPS; HSL1; HINT-5; HSPC015; decapping enzyme, scavenger ; scavenger mRNA-decapping enzyme DcpS; DCS-1; OTTHUMP00000231113; mRNA decapping enzyme; heat shock-like protein 1;histidine triad protein member 5; hint-related 7meGMP-directed hydrolase; homolog of C. elegans 7meGMP-directed hydrolase dcs-1; EC 3
Gene ID	28960
mRNA Refseq	NM_014026
Protein Refseq	NP_054745
MIM	610534
UniProt ID	Q96C86