Recombinant Human DCP2 Protein, GST-tagged

• Cat.No.: DCP2-2402H
• Product Overview: Human DCP2 full-length ORF ( AAH64593, 1 a.a. - 385 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene is a key component of an mRNA-decapping complex required for degradation of mRNAs, both in normal mRNA turnover, and in nonsense-mediated mRNA decay (NMD). It removes the 7-methyl guanine cap structure from mRNA, prior to its degradation from the 5' end. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene.[provided by RefSeq, Jun 2011]
• Molecular Mass: 68.09 kDa
• AA Sequence: METKRVEIPGSVLDDLCSRFILHIPSEERDNAIRVCFQIELAHWFYLDFYMQNTPGLPQCGIRDFAKAVFSHCPFLLPQGEDVEKVLDEWKEYKMGVPTYGAIILDETLENVLLVQGYLAKSGWGFPKGKVNKEEAPHDCAAREVFEETGFDIKDYICKDDYIELRINDQLARLYIIPGIPKDTKFNPKTRREIRNIEWFSIEKLPCHRNDMTPKSKLGLAPNKFFMAIPFIRPLRDWLSRRFGDSSDSDNGFSSTGSTPAKPTVEKLSRTKFRHSQQLFPDGSPGDQWVKHRQPLQQKPYNNHSEMSDLLKGKKCEKKLHPRKLQDNFETDAVYDLPSSSEDQLLEHAEGQPVACNGHCKFPFSSRAFLSFKFDHNAIMKILDL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DCP2 DCP2 decapping enzyme homolog (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: DCP2
• Synonyms: DCP2; DCP2 decapping enzyme homolog (S. cerevisiae); mRNA-decapping enzyme 2; nudix (nucleoside diphosphate linked moiety X) type motif 20; NUDT20; hDpc; nudix (nucleoside diphosphate linked moiety X)-type motif 20; FLJ33245
• Gene ID: 167227
• mRNA Refseq: NM_001242377
• Protein Refseq: NP_001229306
• MIM: 609844
• UniProt ID: Q8IU60