Recombinant Human DCLK1 Protein, GST-tagged
Cat.No. : | DCLK1-2383H |
Product Overview : | Human DCAMKL1 partial ORF ( NP_004725, 640 a.a. - 729 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the protein kinase superfamily and the doublecortin family. The protein encoded by this gene contains two N-terminal doublecortin domains, which bind microtubules and regulate microtubule polymerization, a C-terminal serine/threonine protein kinase domain, which shows substantial homology to Ca2+/calmodulin-dependent protein kinase, and a serine/proline-rich domain in between the doublecortin and the protein kinase domains, which mediates multiple protein-protein interactions. The microtubule-polymerizing activity of the encoded protein is independent of its protein kinase activity. The encoded protein is involved in several different cellular processes, including neuronal migration, retrograde transport, neuronal apoptosis and neurogenesis. This gene is up-regulated by brain-derived neurotrophic factor and associated with memory and general cognitive abilities. Multiple transcript variants generated by two alternative promoter usage and alternative splicing have been reported, but the full-length nature and biological validity of some variants have not been defined. These variants encode different isoforms, which are differentially expressed and have different kinase activities.[provided by RefSeq, Sep 2010] |
Molecular Mass : | 35.53 kDa |
AA Sequence : | QVLEHPWVNDDGLPENEHQLSVAGKIKKHFNTGPKPNSTAAGVSVIALDHGFTIKRSGSLDYYQQPGMYWIRPPLLIRRGRFSDEDATRM |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DCLK1 doublecortin-like kinase 1 [ Homo sapiens ] |
Official Symbol | DCLK1 |
Synonyms | DCLK1; doublecortin-like kinase 1; DCAMKL1, doublecortin and CaM kinase like 1; serine/threonine-protein kinase DCLK1; DCDC3A; DCLK; KIAA0369; doublecortin and CaM kinase-like 1; doublecortin-like and CAM kinase-like 1; doublecortin domain-containing protein 3A; CL1; CLICK1; DCAMKL1; |
Gene ID | 9201 |
mRNA Refseq | NM_001195415 |
Protein Refseq | NP_001182344 |
MIM | 604742 |
UniProt ID | O15075 |
◆ Recombinant Proteins | ||
Dclk1-2473M | Recombinant Mouse Dclk1 Protein, Myc/DDK-tagged | +Inquiry |
DCLK1-0863H | Recombinant Human DCLK1 Protein (S2-F740), GST tagged | +Inquiry |
DCLK1-7843H | Recombinant Human DCLK1 protein, GST-tagged | +Inquiry |
DCLK1-211H | Recombinant Human DCLK1 Protein, His-tagged | +Inquiry |
DCLK1-4602C | Recombinant Chicken DCLK1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
DCLK1-001HCL | Recombinant Human DCLK1 cell lysate | +Inquiry |
DCLK1-435HCL | Recombinant Human DCLK1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DCLK1 Products
Required fields are marked with *
My Review for All DCLK1 Products
Required fields are marked with *
0
Inquiry Basket