Recombinant Human DCLK1 Protein, GST-tagged

Cat.No. : DCLK1-2383H
Product Overview : Human DCAMKL1 partial ORF ( NP_004725, 640 a.a. - 729 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the protein kinase superfamily and the doublecortin family. The protein encoded by this gene contains two N-terminal doublecortin domains, which bind microtubules and regulate microtubule polymerization, a C-terminal serine/threonine protein kinase domain, which shows substantial homology to Ca2+/calmodulin-dependent protein kinase, and a serine/proline-rich domain in between the doublecortin and the protein kinase domains, which mediates multiple protein-protein interactions. The microtubule-polymerizing activity of the encoded protein is independent of its protein kinase activity. The encoded protein is involved in several different cellular processes, including neuronal migration, retrograde transport, neuronal apoptosis and neurogenesis. This gene is up-regulated by brain-derived neurotrophic factor and associated with memory and general cognitive abilities. Multiple transcript variants generated by two alternative promoter usage and alternative splicing have been reported, but the full-length nature and biological validity of some variants have not been defined. These variants encode different isoforms, which are differentially expressed and have different kinase activities.[provided by RefSeq, Sep 2010]
Molecular Mass : 35.53 kDa
AA Sequence : QVLEHPWVNDDGLPENEHQLSVAGKIKKHFNTGPKPNSTAAGVSVIALDHGFTIKRSGSLDYYQQPGMYWIRPPLLIRRGRFSDEDATRM
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DCLK1 doublecortin-like kinase 1 [ Homo sapiens ]
Official Symbol DCLK1
Synonyms DCLK1; doublecortin-like kinase 1; DCAMKL1, doublecortin and CaM kinase like 1; serine/threonine-protein kinase DCLK1; DCDC3A; DCLK; KIAA0369; doublecortin and CaM kinase-like 1; doublecortin-like and CAM kinase-like 1; doublecortin domain-containing protein 3A; CL1; CLICK1; DCAMKL1;
Gene ID 9201
mRNA Refseq NM_001195415
Protein Refseq NP_001182344
MIM 604742
UniProt ID O15075

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All DCLK1 Products

Required fields are marked with *

My Review for All DCLK1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon