Recombinant Human DCLK1 Protein, GST-tagged

• Cat.No.: DCLK1-2383H
• Product Overview: Human DCAMKL1 partial ORF ( NP_004725, 640 a.a. - 729 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a member of the protein kinase superfamily and the doublecortin family. The protein encoded by this gene contains two N-terminal doublecortin domains, which bind microtubules and regulate microtubule polymerization, a C-terminal serine/threonine protein kinase domain, which shows substantial homology to Ca2+/calmodulin-dependent protein kinase, and a serine/proline-rich domain in between the doublecortin and the protein kinase domains, which mediates multiple protein-protein interactions. The microtubule-polymerizing activity of the encoded protein is independent of its protein kinase activity. The encoded protein is involved in several different cellular processes, including neuronal migration, retrograde transport, neuronal apoptosis and neurogenesis. This gene is up-regulated by brain-derived neurotrophic factor and associated with memory and general cognitive abilities. Multiple transcript variants generated by two alternative promoter usage and alternative splicing have been reported, but the full-length nature and biological validity of some variants have not been defined. These variants encode different isoforms, which are differentially expressed and have different kinase activities.[provided by RefSeq, Sep 2010]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 35.53 kDa
• AA Sequence: QVLEHPWVNDDGLPENEHQLSVAGKIKKHFNTGPKPNSTAAGVSVIALDHGFTIKRSGSLDYYQQPGMYWIRPPLLIRRGRFSDEDATRM
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DCLK1 doublecortin-like kinase 1 [ Homo sapiens ]
• Official Symbol: DCLK1
• Synonyms: DCLK1; doublecortin-like kinase 1; DCAMKL1, doublecortin and CaM kinase like 1; serine/threonine-protein kinase DCLK1; DCDC3A; DCLK; KIAA0369; doublecortin and CaM kinase-like 1; doublecortin-like and CAM kinase-like 1; doublecortin domain-containing protein 3A; CL1; CLICK1; DCAMKL1
• Gene ID: 9201
• mRNA Refseq: NM_001195415
• Protein Refseq: NP_001182344
• MIM: 604742
• UniProt ID: O15075