Recombinant Human DCD protein, GST-tagged
Cat.No. : | DCD-2802H |
Product Overview : | Recombinant Human DCD protein(P81605)(20-110aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 20-110aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 36.3 kDa |
AA Sequence : | YDPEAASAPGSGNPCHEASAAQKENAGEDPGLARQAPKPRKQRSSLLEKGLDGAKKAVGGLGKLGKDAVEDLESVGKGAVHDVKDVLDSVL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | DCD dermcidin [ Homo sapiens ] |
Official Symbol | DCD |
Synonyms | DCD; dermcidin; AIDD; DCD 1; diffusible survival/evasion peptide; DSEP; HCAP; PIF; preproteolysin; proteolysis inducing factor; survival promoting peptide; DCD-1; MGC71930; |
Gene ID | 117159 |
mRNA Refseq | NM_053283 |
Protein Refseq | NP_444513 |
MIM | 606634 |
UniProt ID | P81605 |
◆ Recombinant Proteins | ||
DCD-1739H | Recombinant Human DCD Protein (Cys18-Leu110), His tagged | +Inquiry |
DCD-650HFL | Recombinant Full Length Human DCD Protein, C-Flag-tagged | +Inquiry |
DCD-2802H | Recombinant Human DCD protein, GST-tagged | +Inquiry |
DCD-1376H | Recombinant Human DCD Protein (20-110 aa), His-tagged | +Inquiry |
DCD-1183S | Recombinant Streptomyces coelicolor A3(2) DCD protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DCD-7053HCL | Recombinant Human DCD 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DCD Products
Required fields are marked with *
My Review for All DCD Products
Required fields are marked with *
0
Inquiry Basket