Recombinant Human DCD protein, GST-tagged

Cat.No. : DCD-2802H
Product Overview : Recombinant Human DCD protein(P81605)(20-110aa), fused to N-terminal GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 20-110aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 36.3 kDa
AA Sequence : YDPEAASAPGSGNPCHEASAAQKENAGEDPGLARQAPKPRKQRSSLLEKGLDGAKKAVGGLGKLGKDAVEDLESVGKGAVHDVKDVLDSVL
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name DCD dermcidin [ Homo sapiens ]
Official Symbol DCD
Synonyms DCD; dermcidin; AIDD; DCD 1; diffusible survival/evasion peptide; DSEP; HCAP; PIF; preproteolysin; proteolysis inducing factor; survival promoting peptide; DCD-1; MGC71930;
Gene ID 117159
mRNA Refseq NM_053283
Protein Refseq NP_444513
MIM 606634
UniProt ID P81605

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All DCD Products

Required fields are marked with *

My Review for All DCD Products

Required fields are marked with *

0

Inquiry Basket

cartIcon